PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27446.7 Da    PI: 9.2061
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941167.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.22.9e-301059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  XP_010941167.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS 59
                    8***********************************************96 PP

2K-box75.61.3e-2582171897
           K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                     +++e+++++++ e++ + k+ie L+  +R+llGe+L+s+sl+eL+ +e qLe+sl ki+++K+++l+eqi +l++ke+ l een +Lr k
  XP_010941167.1  82 RATEQNMQQWRAEAEAMTKKIEHLEAYKRKLLGEGLGSCSLEELHGVEMQLEQSLIKIKERKYHMLMEQIARLKEKERILLEENLSLRGK 171
                     4789**********************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-40160IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-30323IPR002100Transcription factor, MADS-box
CDDcd002651.51E-39376No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-31375IPR002100Transcription factor, MADS-box
PfamPF003192.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2584170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.16388182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVRGKTEVRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP KGKLYEFSSS  60
SSIQKTVDRY LMHTKDVNIN IRATEQNMQQ WRAEAEAMTK KIEHLEAYKR KLLGEGLGSC  120
SLEELHGVEM QLEQSLIKIK ERKYHMLMEQ IARLKEKERI LLEENLSLRG KERILFKENS  180
SLHGKCKTEP PVQLITQASS NGDACQNMEV ETELIIGRPG TCEAKQQDHV SLNKQWSQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-16378272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-16378272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-16378272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-16378272MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-16378272Myocyte-specific enhancer factor 2A
3p57_I4e-16378272Myocyte-specific enhancer factor 2A
3p57_D4e-16378272Myocyte-specific enhancer factor 2A
3p57_C4e-16378272Myocyte-specific enhancer factor 2A
3p57_B4e-16378272Myocyte-specific enhancer factor 2A
3p57_A4e-16378272Myocyte-specific enhancer factor 2A
3kov_J4e-16378272Myocyte-specific enhancer factor 2A
3kov_I4e-16378272Myocyte-specific enhancer factor 2A
3kov_B4e-16378272Myocyte-specific enhancer factor 2A
3kov_A4e-16378272Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941167.11e-177PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_010941168.11e-177PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotA2Z9Q78e-80MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLQ400I32e-90Q400I3_ELAGV; AGL20-like MADS box transcription factor
STRINGGSMUA_Achr2P04340_0013e-82(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-55AGAMOUS-like 19